Wellness

Adult Feline Core - Original Turkey, Chicken

W183868

$40.99 – $53.99

Free shipping on orders over $49*
Earn 41 – 54 Ren's Reward Points

 

Wellness CORE Natural Grain Free Dry Cat Food Original TurkeyChickenWhitefish & Herring Recipe is healthy100% natural grain free cat food for adult cats made with turkeychickenwhitefishherringsalmon oil and cranberries to help support your cat's optimal health and fortified with antioxidantsprobioticsvitamins and mineralsincluding fish and flax omega blend for healthy skin and coat. Wellness CORE grain free cat food formulas are based on the nutritional philosophy that cats thrive on a diet mainly comprised of meat. Each grain freenutrient-rich formula provides high quality protein for your cat with no meat by-products or fillersgraincornsoywheat-gluten or artificial preservativescolors or flavors.

  • SAVORY FOOD CATS LOVE: Because cats naturally crave meateach bite is packed with a high concentration of quality animal protein from turkey along with nutrient rich superfoods and added nutritional supplements for an amazing flavor cats love

  • ELEVATED NUTRITION FOR A LIFETIME OF WELLBEING: Wellness CORE pairs the best of science and natural; working with our staff of vetsnutritionists and scientistswe create each diet to deliver everything your cat needs to thrivefor a lifetime

  • WHOLE BODY HEALTH: This recipe is crafted to deliver everything your cat needs to be healthy; energy for playtimea lustrous skin and coatsound digestion and immunitystrong teeth and healthy eyesplus controlled vitamins and minerals

  • CATISFACTION PROMISE: Wellness CORE offers a full range of wet and dry food to support your cat's specific cat preferences and needs; with dozens of tastes and textureswe are confident you will find one your feline will love

  • MADE IN THE USA: using only the finest globally sourced ingredientswe prepare each of our diets in our own state of the art facility; we craft delicious natural recipes with wholesome ingredients chosen for their nutritional benefits

  • Manufactured in a facility that also processes grains

  • Deboned Turkey

  • Deboned Chicken

  • Turkey Meal

  • Chicken Meal

  • Peas

  • Herring Meal

  • Chicken Fat (preserved with Mixed Tocopherols)

  • Dried Ground Potatoes

  • Tomato Pomace

  • Ground Flaxseed

  • Natural Chicken Flavor

  • Salmon Oil

  • Cranberries

  • Chicory Root Extract

  • Choline Chloride

  • Taurine

  • Vitamin E Supplement

  • Dried Kelp

  • Zinc Proteinate

  • Mixed Tocopherols (added to preserve freshness)

  • Zinc Sulfate

  • Calcium Carbonate

  • Niacin

  • Iron Proteinate

  • Ferrous Sulfate

  • Yucca Schidigera Extract

  • Vitamin A Supplement

  • Copper Sulfate

  • Thiamine Mononitrate

  • Copper Proteinate

  • Manganese Proteinate

  • Manganese Sulfate

  • d-Calcium Pantothenate

  • Sodium Selenite

  • Pyridoxine Hydrochloride

  • Riboflavin

  • Vitamin D3 Supplement

  • Biotin

  • Calcium Iodate

  • Vitamin B12 Supplement

  • Folic Acid

  • Ascorbic Acid (Vitamin C)

  • Dried Lactobacillus plantarum Fermentation Product

  • Dried Enterococcus faecium Fermentation Product

  • Dried Lactobacillus casei Fermentation Product

  • Dried Lactobacillus acidophilus Fermentation Product

  • Rosemary Extract

  • Green Tea Extract

  • Spearmint Extract.

Weight of Cat (Lbs) Weight of Cat (Kg) Dry Food Alone (cups/day) Dry Food Alone (grams/day) Combination Feeding
4 - 7 2 – 3 ¼ - ? 40 - 53 ¼ + 3 oz can†
7 - 10 3 – 5 ? - ½ 53 - 65 ? + 3 oz can†
10 - 15 5 – 7 ½ - ? 65 - 81 ½ + 3 oz can†

CATS OVER 15 LBS: Add approximately ? cup for each additional 2 lbs of body weight.

  • Crude Protein Not less than 45.00%
    Crude Fat Not less than 18.00%
    Crude Fiber Not more than 3.00%
    Moisture Not more than 10.00%
    Calcium Not more than 2.10%
    Phosphorus Not more than 1.60%
    Vitamin A Not less than 25,000 IU/kg
    Vitamin E Not less than 200 IU/kg
    Taurine Not less than 0.20%
    Omega-6 Fatty Acids* Not less than 4.75%
    Omega-3 Fatty Acids* Not less than 1.25%
    Total Lactic Acid Microorganisms* Not less than 90,000,000 CFU/lb
    (Lactobacillus plantarum

  • Enterococcus faecium

  • Lactobacillus casei

  • Lactobacillus acidophilus in equal amounts)
    *Not recognized as an essential nutrient by the AAFCO Cat Food Nutrient Profiles

Description

 

Wellness CORE Natural Grain Free Dry Cat Food Original TurkeyChickenWhitefish & Herring Recipe is healthy100% natural grain free cat food for adult cats made with turkeychickenwhitefishherringsalmon oil and cranberries to help support your cat's optimal health and fortified with antioxidantsprobioticsvitamins and mineralsincluding fish and flax omega blend for healthy skin and coat. Wellness CORE grain free cat food formulas are based on the nutritional philosophy that cats thrive on a diet mainly comprised of meat. Each grain freenutrient-rich formula provides high quality protein for your cat with no meat by-products or fillersgraincornsoywheat-gluten or artificial preservativescolors or flavors.

  • SAVORY FOOD CATS LOVE: Because cats naturally crave meateach bite is packed with a high concentration of quality animal protein from turkey along with nutrient rich superfoods and added nutritional supplements for an amazing flavor cats love
  • ELEVATED NUTRITION FOR A LIFETIME OF WELLBEING: Wellness CORE pairs the best of science and natural; working with our staff of vetsnutritionists and scientistswe create each diet to deliver everything your cat needs to thrivefor a lifetime
  • WHOLE BODY HEALTH: This recipe is crafted to deliver everything your cat needs to be healthy; energy for playtimea lustrous skin and coatsound digestion and immunitystrong teeth and healthy eyesplus controlled vitamins and minerals
  • CATISFACTION PROMISE: Wellness CORE offers a full range of wet and dry food to support your cat's specific cat preferences and needs; with dozens of tastes and textureswe are confident you will find one your feline will love
  • MADE IN THE USA: using only the finest globally sourced ingredientswe prepare each of our diets in our own state of the art facility; we craft delicious natural recipes with wholesome ingredients chosen for their nutritional benefits
  • Manufactured in a facility that also processes grains

SKU:

Ingredients
  • Deboned Turkey

  • Deboned Chicken

  • Turkey Meal

  • Chicken Meal

  • Peas

  • Herring Meal

  • Chicken Fat (preserved with Mixed Tocopherols)

  • Dried Ground Potatoes

  • Tomato Pomace

  • Ground Flaxseed

  • Natural Chicken Flavor

  • Salmon Oil

  • Cranberries

  • Chicory Root Extract

  • Choline Chloride

  • Taurine

  • Vitamin E Supplement

  • Dried Kelp

  • Zinc Proteinate

  • Mixed Tocopherols (added to preserve freshness)

  • Zinc Sulfate

  • Calcium Carbonate

  • Niacin

  • Iron Proteinate

  • Ferrous Sulfate

  • Yucca Schidigera Extract

  • Vitamin A Supplement

  • Copper Sulfate

  • Thiamine Mononitrate

  • Copper Proteinate

  • Manganese Proteinate

  • Manganese Sulfate

  • d-Calcium Pantothenate

  • Sodium Selenite

  • Pyridoxine Hydrochloride

  • Riboflavin

  • Vitamin D3 Supplement

  • Biotin

  • Calcium Iodate

  • Vitamin B12 Supplement

  • Folic Acid

  • Ascorbic Acid (Vitamin C)

  • Dried Lactobacillus plantarum Fermentation Product

  • Dried Enterococcus faecium Fermentation Product

  • Dried Lactobacillus casei Fermentation Product

  • Dried Lactobacillus acidophilus Fermentation Product

  • Rosemary Extract

  • Green Tea Extract

  • Spearmint Extract.

Instructions Directions

Weight of Cat (Lbs) Weight of Cat (Kg) Dry Food Alone (cups/day) Dry Food Alone (grams/day) Combination Feeding
4 - 7 2 – 3 ¼ - ? 40 - 53 ¼ + 3 oz can†
7 - 10 3 – 5 ? - ½ 53 - 65 ? + 3 oz can†
10 - 15 5 – 7 ½ - ? 65 - 81 ½ + 3 oz can†

CATS OVER 15 LBS: Add approximately ? cup for each additional 2 lbs of body weight.

Guarantee Analysis
  • Crude Protein Not less than 45.00%
    Crude Fat Not less than 18.00%
    Crude Fiber Not more than 3.00%
    Moisture Not more than 10.00%
    Calcium Not more than 2.10%
    Phosphorus Not more than 1.60%
    Vitamin A Not less than 25,000 IU/kg
    Vitamin E Not less than 200 IU/kg
    Taurine Not less than 0.20%
    Omega-6 Fatty Acids* Not less than 4.75%
    Omega-3 Fatty Acids* Not less than 1.25%
    Total Lactic Acid Microorganisms* Not less than 90,000,000 CFU/lb
    (Lactobacillus plantarum

  • Enterococcus faecium

  • Lactobacillus casei

  • Lactobacillus acidophilus in equal amounts)
    *Not recognized as an essential nutrient by the AAFCO Cat Food Nutrient Profiles

Product Availability

Select product options to view inventory in stores near you.

Top of Page